SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015331474.1.89626 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015331474.1.89626
Domain Number 1 Region: 244-391
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.19e-31
Family Glutathione peroxidase-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015331474.1.89626
Sequence length 392
Comment Thiol-disulfide oxidoreductase resA [Fibrella aestuarina]; AA=GCF_000331105.1; RF=representative genome; TAX=1166018; STAX=651143; NAME=Fibrella aestuarina BUZ 2; strain=BUZ 2; AL=Chromosome; RT=Major
Sequence
MMKKSIGVGLLLLTLSASAQTTPFVLHGRLDQSPAKWIYLKYVDRTGEEKLDSAQITQGA
FIFTGQLSQPTKALIKTNRTIIPDEENLNIALIFLEPTTMQVKAVHNQFRSLTLKGSKTH
DEFNRLTALHAPYLKQYFSLRERSAQLAKQSPQTGDGDSRQSQQDSINQAIVANAVAKRL
VSYRFIEDNPNSWASAYELDFFKSTWPVDSVRRLYGRLNPNIQESLIGQRIAEKITMLDQ
ANTAVGTIAADFSAIDASGHPIRLADYKGRYVLLDFWGSWCAPCRAGNPHLRKLYQAYRQ
KGIEFIGIACEDKPVAWRTAIEKDSIGVWKHILDTEMKGDRVVGSQKSIARKYAVDSFPT
KVLIDPKGVIVGRYNGGNDSQLDEKLKDVLGN
Download sequence
Identical sequences I0K8C2
gi|436835752|ref|YP_007320968.1| WP_015331474.1.89626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]