SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015337633.1.21188 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015337633.1.21188
Domain Number 1 Region: 34-107
Classification Level Classification E-value
Superfamily Fe-only hydrogenase smaller subunit 6.93e-17
Family Fe-only hydrogenase smaller subunit 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015337633.1.21188
Sequence length 112
Comment iron hydrogenase small subunit [Desulfovibrio hydrothermalis]; AA=GCF_000331025.1; RF=representative genome; TAX=1121451; STAX=191026; NAME=Desulfovibrio hydrothermalis AM13 = DSM 14728; strain=AM13; AL=Chromosome; RT=Major
Sequence
MNISRRSFIKAAGIMTGYAVLSMNIAKEAVADVMGFVARRQESVYAADANPEVYKYRKSQ
NNPMITKIYDPENGFLHDGPCGHESHELLHTHYIDRSEKLKALKEKGIELNI
Download sequence
Identical sequences L0RFR0
gi|436842756|ref|YP_007327134.1| gi|551596640|ref|YP_008685933.1| WP_015337633.1.21188 WP_015337633.1.81540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]