SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015452689.1.18731 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015452689.1.18731
Domain Number 1 Region: 18-176
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.58e-49
Family NQO2-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015452689.1.18731
Sequence length 218
Comment NADH-quinone oxidoreductase subunit E [Candidatus Liberibacter asiaticus]; AA=GCF_000820625.1; RF=na; TAX=34021; STAX=34021; NAME=Candidatus Liberibacter asiaticus; strain=FL17; AL=Contig; RT=Major
Sequence
MSVRRLAEEEFQPSSFSFSEESAIWVNEVISRYPPSRCQSAVIPLLMRAQEQEGWVSRAA
IEVVANILDMAYIRVLEIATFYTQFQLSPVGTRAHVQVCGTTPCMLRGCEKLIEVCRNKI
HQKPLHRNSDGTLSWEEVECQGACVNAPMVMIGKDTYEDLTPERLEEIIDAFSTGQGDTI
RPGPQIDRISSAPAGGLTSLLDNNSKKRGKKKKDDKIS
Download sequence
Identical sequences C6XG26
gi|470205215|ref|YP_007599313.1| 537021.CLIBASIA_03755 gi|254780856|ref|YP_003065269.1| WP_015452689.1.15810 WP_015452689.1.15976 WP_015452689.1.16756 WP_015452689.1.18731 WP_015452689.1.3509 WP_015452689.1.50033 WP_015452689.1.77054 WP_015452689.1.78654 WP_015452689.1.94010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]