SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015452799.1.15976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015452799.1.15976
Domain Number 1 Region: 4-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.21e-34
Family Thioltransferase 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015452799.1.15976
Sequence length 106
Comment monothiol glutaredoxin, Grx4 family [Candidatus Liberibacter asiaticus]; AA=GCF_001430705.1; RF=na; TAX=34021; STAX=34021; NAME=Candidatus Liberibacter asiaticus; AL=Contig; RT=Major
Sequence
MNSSVNSIIQNEIKKNDVVLFMKGTPTSPRCGFSGKVVQVLDSLGVSYKGIDVLADDALR
QSIKEYSNWPTIPQLYVKGDFIGGCDIVCEMFESGELHEILSIDRI
Download sequence
Identical sequences C6XGD8
537021.CLIBASIA_04345 gi|470205326|ref|YP_007599424.1| gi|254780968|ref|YP_003065381.1| WP_015452799.1.15810 WP_015452799.1.15976 WP_015452799.1.16756 WP_015452799.1.18731 WP_015452799.1.3509 WP_015452799.1.50033 WP_015452799.1.77054 WP_015452799.1.78654 WP_015452799.1.79050 WP_015452799.1.94010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]