SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015480101.1.7039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015480101.1.7039
Domain Number 1 Region: 9-117
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 4.12e-16
Family Intron-encoded homing endonucleases 0.00069
Further Details:      
 
Weak hits

Sequence:  WP_015480101.1.7039
Domain Number - Region: 138-173
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0735
Family Tetracyclin repressor-like, N-terminal domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015480101.1.7039
Sequence length 183
Comment hypothetical protein [Polaribacter sp. MED152]; AA=GCF_000152945.2; RF=na; TAX=313598; STAX=313598; NAME=Polaribacter sp. MED152; strain=MED152; AL=Complete Genome; RT=Major
Sequence
MIRNLYNEEWKDIQFDEKIAVNEKYQISNYGRVINCNTEVPYLRNKTFINGYETISLKQE
VNKKSTSRYVHKLVAQHFIDKENEEQRYVIHLDYDKKNNEVSNLKWATKREKELHQFNNP
TWESVVKKRSRNIGKLSEGKVKIIKRQLKNNRTRISMIAKRFGVSDMQIHRIKTGENWSH
VKI
Download sequence
Identical sequences A2U2F1
gi|472320841|ref|YP_007670366.1| WP_015480101.1.7039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]