SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015492680.1.41762 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015492680.1.41762
Domain Number 1 Region: 38-94
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000235
Family Type I dockerin domain 0.0027
Further Details:      
 
Weak hits

Sequence:  WP_015492680.1.41762
Domain Number - Region: 120-421
Classification Level Classification E-value
Superfamily "Helical backbone" metal receptor 0.00051
Family TM0189-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015492680.1.41762
Sequence length 451
Comment hypothetical protein [Thermoplasmatales archaeon BRNA1]; AA=GCF_000350305.1; RF=representative genome; TAX=1054217; STAX=1054217; NAME=Thermoplasmatales archaeon BRNA1; strain=BRNA1; AL=Complete Genome; RT=Major
Sequence
MVAAVVAVVVVVGAGCFVLFGNGNDSGSSADIASKLQIRGNANDDHTINSDDMAIVQDII
NGTRNKDDFPLADVNDDGKVNETDVSLLQDLIDRKEGCTVYVICLDRDGKNTSVSCTYPL
RNVVPYGTNVQEPVLYANGGQYVAGYFVSSYDVADASIAKTAVNLHGTTRTISATAWSNF
TKLDSDLISKGGVGALIVDYSGIAQITAARADDCAKAGIPMLIFSSADATDETTTVLTLG
FLFGGDCEKLGVKYAQIAWDVIEFVKSKVGGYTNEQKVTYICCTMYIYLCGKTSTFNTTA
TTAGGYAYANVNADFDAATPKNSQKMGGTEAMANYTTVGKVINNRSMDFGLDADGIKAMI
IDTWDHDNDGVSSKVYFKGYDDKLVYVNNLLPGGAKIAYMAHAMYPDLFSKSWADDVLKD
YINTGTMPLKGQTLSSICSYIDVNDYNAAIA
Download sequence
Identical sequences M4YQI2
gi|474934741|ref|YP_007688323.1| WP_015492680.1.41762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]