SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015497944.1.44912 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015497944.1.44912
Domain Number 1 Region: 80-185
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.34e-16
Family Glutathione S-transferase (GST), C-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 1-65
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000595
Family Glutathione S-transferase (GST), N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015497944.1.44912
Sequence length 194
Comment glutathione S-transferase [Octadecabacter antarcticus]; AA=GCF_000155675.2; RF=na; TAX=391626; STAX=1217908; NAME=Octadecabacter antarcticus 307; strain=307; AL=Complete Genome; RT=Major
Sequence
MRARLAIASAGLTVELREILLRDKAPDFLTTSPKGTVPVMVADEVIEESRNIMHWALGRS
DPERLLPDMTENATALIAECDGSFKIALDHTKYAVRYPDIDAAESRATAASFITKLDAQL
DTKRWLYGDSPSFADLAILPFVRQFAHTDLDWWDRQSFTHAHSWLAAFKSSARFTSIMKK
YPPWKSGQDRVLFP
Download sequence
Identical sequences M9R296
WP_015497944.1.44912 gi|478181447|ref|YP_007702517.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]