SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015499238.1.44912 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015499238.1.44912
Domain Number 1 Region: 91-211
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.51e-30
Family Glutathione S-transferase (GST), C-terminal domain 0.0047
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.01e-20
Family Glutathione S-transferase (GST), N-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015499238.1.44912
Sequence length 231
Comment thiol:disulfide oxidoreductase [Octadecabacter antarcticus]; AA=GCF_000155675.2; RF=na; TAX=391626; STAX=1217908; NAME=Octadecabacter antarcticus 307; strain=307; AL=Complete Genome; RT=Major
Sequence
MIDLYYWPTPNGWKVTIALEEMHLPYRVNLIDIGAGDQFKPDFLVVAPNNRMPAITDPDG
PDGAPISIFESGAILQYLVRKTGQFGGPTERDRIAVDQWLMWQMGGLGPMAGQAHHFLKY
APNMDPPQDIPYAKDRYRTETARLYGVLDRQLTNYEFVAGDFYSIADMSIWGWASLWQGQ
QQTLDDKPNLKRWLDDVTARAGVQKGRAVAAEKRGDFKGSKTTQDTLFKRS
Download sequence
Identical sequences M9R602
gi|478182767|ref|YP_007703837.1| WP_015499238.1.44912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]