SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015500401.1.44912 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015500401.1.44912
Domain Number 1 Region: 3-104
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.99e-33
Family Thioltransferase 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015500401.1.44912
Sequence length 119
Comment monothiol glutaredoxin, Grx4 family [Octadecabacter antarcticus]; AA=GCF_000155675.2; RF=na; TAX=391626; STAX=1217908; NAME=Octadecabacter antarcticus 307; strain=307; AL=Complete Genome; RT=Major
Sequence
MTAETQIKETVTANDVVLFMKGTKSMPQCGFSSRVAGVLNFMGVEFADVNVLADEDLRQG
IKDYSDWPTVPQLYVKGEFVGGCDIITEMTMSGELDALFAENGVTYDKDAAEKIREANT
Download sequence
Identical sequences M9RF29
WP_015500401.1.44912 gi|478183969|ref|YP_007705039.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]