SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015731256.1.14155 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_015731256.1.14155
Domain Number - Region: 7-115
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0133
Family SMI1/KNR4-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015731256.1.14155
Sequence length 164
Comment hypothetical protein [Pectobacterium parmentieri]; AA=GCF_000024645.1; RF=na; TAX=561231; STAX=1905730; NAME=Pectobacterium parmentieri WPP163; strain=WPP163; AL=Complete Genome; RT=Major
Sequence
MEIKLKVNKKPVELDEFLNEEEMELSPFHFSLVELSQYLNGFIDITFNDKLNVRLDLFSD
FSVCLEDIIDSINAAKTRNCKSEKIWFCEQGSDFYIYYKVNENILSLSYKKGEEVGGINK
EMPDFIVHVDTSEYIEKWRNVFQELRILFEQVLHKKIPSPLQHQ
Download sequence
Identical sequences D0KMK1
WP_015731256.1.14155 561231.Pecwa_3818 gi|261823053|ref|YP_003261159.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]