SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015733829.1.35877 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_015733829.1.35877
Domain Number - Region: 17-112
Classification Level Classification E-value
Superfamily E set domains 0.00462
Family Arrestin/Vps26-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015733829.1.35877
Sequence length 257
Comment sporulation protein [Paenibacillus sp. Y412MC10]; AA=GCF_000024685.1; RF=na; TAX=481743; STAX=481743; NAME=Paenibacillus sp. Y412MC10; strain=Y412MC10; AL=Complete Genome; RT=Major
Sequence
MSFFNKMLASVGIGAAQIDTHLEKSSYYPGEEVRGIIHIKGGNVEQTVDRIYLKLMTEYT
RESDDKKYIESYTIAKVNVSSRLTLKPGDQQEIPFAFPLPLETPLTISRQPVWIHTGLDI
DNAIDPKDRDFIDVEPNEDASIVFDAVESLGFSFKIATCEYHPRLGQGVPFVQEIEFYPG
SSYAGHIKELELILYPEQEGISILVEVDRRGRGVSGWLQRSLDMDEQHSWVTLDKQDLAQ
GPSHVAQILDRVIRRSI
Download sequence
Identical sequences D3EJD4
481743.GYMC10_1319 WP_015733829.1.35877 gi|261405172|ref|YP_003241413.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]