SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015748010.1.85990 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015748010.1.85990
Domain Number 1 Region: 2-252
Classification Level Classification E-value
Superfamily Cgl1923-like 1.7e-86
Family Cgl1923-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015748010.1.85990
Sequence length 286
Comment PAC2 family protein [Nakamurella multipartita]; AA=GCF_000024365.1; RF=representative genome; TAX=479431; STAX=53461; NAME=Nakamurella multipartita DSM 44233; strain=DSM 44233; AL=Complete Genome; RT=Major
Sequence
MSEFMPLRNPVMIAAFEGWNDAGDAASAAVEQLGLIWDAVPLTELDPEGFYDFQVTRPTV
RLVDGVTRTIEWPTTRLSVCRLPDSPSDVILVHGIEPNFRWRAFCDELLKIAVDHQVSKV
IGLGALLADVPHTRPIQVTGSAHDEQTAVSLGLTRSRYEGPTGISGVFQDACVQAGIPAL
SFWASVPHYVSQAPSPKATLALLHRVEEVLDVAVPLGNLPAQADEWEAEVSQIASEDEEI
SEYIRSLEEREEQDEPLKPASGESIAAEFERYLRRRGPKPGGDSWR
Download sequence
Identical sequences C8X8S6
WP_015748010.1.85990 gi|258652964|ref|YP_003202120.1| 479431.Namu_2785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]