SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015766963.1.47741 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015766963.1.47741
Domain Number 1 Region: 130-560
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 1.83e-112
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0000000000376
Further Details:      
 
Domain Number 2 Region: 10-133
Classification Level Classification E-value
Superfamily Cytochrome c 5.3e-20
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015766963.1.47741
Sequence length 560
Comment nitrite reductase [Candidatus Accumulibacter phosphatis]; AA=GCF_000024165.1; RF=na; TAX=522306; STAX=327160; NAME=Candidatus Accumulibacter phosphatis clade IIA str. UW-1; strain=UW-1; AL=Complete Genome; RT=Major
Sequence
MQKGIRSVLMLAVLPVAMNLAFAAPAEKAAAPAAAPAAAPAAPTLSAEDKAASGKTYFER
CAGCHGMLRKGATGKNLEPANTTKLGSSRLEKIMSYGTEGGMPNFDDILTKKEIANMAAY
VQMPAEAPPEWSLADIKGSWKLLIPVDKRPTKQMNKVNLANVFAVTLRDSGEVALIDGDT
KKIWVVIKTGYAVHISRMSTSGRYLHVIGRDGRYDLIDLWSETPTTVATLKAGFEARSIE
TTKFKGYEDKYAVVGSYWPPQYTILDGLTLEPLKNVSTRGNTVDGNYHPEPRVASIVASE
SKPEWVINIKETGMIRLVNYSDLANLKETTINSAKFLHDGGWDSSKRYFLVAANASNKVA
VVDTKEGKLAALVDTAKIPHPGRGANFKHPKYGPVWATSHLGADVISVIGTDPAGNPQSA
WKVVQELKNHGANSLFVKTHPKSENLWADAPLNPDPKLAGSVTVYKIADLGNPDPKPEVL
DLAAAADLGKTKGVQRVVHGEYNEKGDEIWFSVWTGNKTEPSAIVVVDDKTRKVKTVIKD
PRLVTPTGKFNVYNTMHDIY
Download sequence
Identical sequences C7RR96
WP_015766963.1.47741 2001062690 522306.CAP2UW1_2489 gi|257094065|ref|YP_003167706.1| 2000203520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]