SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015767841.1.47741 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015767841.1.47741
Domain Number 1 Region: 22-382
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 5.75e-74
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015767841.1.47741
Sequence length 387
Comment protein nirF [Candidatus Accumulibacter phosphatis]; AA=GCF_000024165.1; RF=na; TAX=522306; STAX=327160; NAME=Candidatus Accumulibacter phosphatis clade IIA str. UW-1; strain=UW-1; AL=Complete Genome; RT=Major
Sequence
MNRLFALLWIALLTGCAAPPLRGTGDLGLVIERASGQVTLVDTSRREPYARIGGFGDLSH
ASVVYSRDGRYAYVFGRDGGLTKVDMLTARIVRRVLQSGNAIGGSISQDGRIVVAQNYTP
GGIKAFDAETLELLSEVPAEYAPGSFSKVVGLADLSGNRFAYALFDGGEIWVSDFSDPRR
PRTQRYPAGLQPYDGLVTPDGRYYLAGLFGEDGVALLDTWQPEQGSRRILANYGRGQEKL
PVFKMPHLRGWSLAQGNAYLPAIGRHEVLVVSGSNWREVGRIKVKGQPVFVIARPDGRQV
WVNYAFPDNGWVEVIDTLTGQVVRTLEPGKAILHMEFTPRGEQVWISARDDDKVLIYDTA
TFARIGEFTAQAPSGIFFTSRAGRTGF
Download sequence
Identical sequences C7RJ57
gi|257094956|ref|YP_003168597.1| WP_015767841.1.47741 2000176560 522306.CAP2UW1_3408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]