SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015783430.1.62203 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015783430.1.62203
Domain Number 1 Region: 270-367
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.63e-24
Family Flavin-binding PAS domain 0.031
Further Details:      
 
Domain Number 2 Region: 450-656
Classification Level Classification E-value
Superfamily PP2C-like 0.000000288
Family PP2C-like 0.0088
Further Details:      
 
Domain Number 3 Region: 201-249
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000000418
Family HAMP domain 0.01
Further Details:      
 
Weak hits

Sequence:  WP_015783430.1.62203
Domain Number - Region: 58-113
Classification Level Classification E-value
Superfamily Sensory domain-like 0.000231
Family Sensory domain of two-component sensor kinase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015783430.1.62203
Sequence length 670
Comment histidine kinase [Cyanothece sp. PCC 8802]; AA=GCF_000024045.1; RF=na; TAX=395962; STAX=395962; NAME=Cyanothece sp. PCC 8802; strain=PCC 8802; AL=Complete Genome; RT=Major
Sequence
MKISRLVKQTLIFAALVFAVIGISLSIFSVWNLSQNLLYEYENKGSAMTRTIAGFTSEII
FDENHETIQALVDSFVDIEGLAYILVQDQTGAIIAHTFSPGIPKFFQDHEKYKLNQINQI
NQKNYRFTQQTKIEKLTIPEIGPIIDVELPILGLAGGDIHLGLSRHIINQKIWLATIEQV
IIITILFILTAIAAYMVVKQISQDLNKLIKGVNRVQLGDYGVTISVNDTNEIGLLANAFN
SMVAEIRHYAQHLNKSVQELSDIKYALDQSAIIAITNVHGTIIKTNDRMSEISGYSEQEL
LGNNHRMLKSGYHPPEFFADLWSTITRGEIWQGEIKNKAKDGRYYWVDTTIVPFKNEMRE
IFQFLSLQNEITTRKEFEESLEENVRKRTEQLAQANEEITMLNVQLKTENFRMGAELNLL
RQMQQLILPKAEEISVIEELDIAGFMEPASEVGGDYYDVLYTDGVVTLGIGDVAGHGLES
GILMVMIQTAVRTLTEIKEADPVKFLSTLNRTIYNNIQRMNSDKNLSLAVLNYTAGQLRI
TGQHEETLIVRSDGKIERINTMDLGFPIGLDHDITQFIDQVLIELNPGDGVVLYTDGITE
AKDINKNQYGLERLCRIISENWNKSAQQIEEAVIDDLLNHIGQQKVFDDLTLVVVKQKKI
LDDAEWIIDN
Download sequence
Identical sequences WP_015783430.1.62203 395962.Cyan8802_1034 gi|257058914|ref|YP_003136802.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]