SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015784299.1.62203 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015784299.1.62203
Domain Number 1 Region: 45-386
Classification Level Classification E-value
Superfamily Pectin lyase-like 4.08e-48
Family Filamentous hemagglutinin FhaB, secretion domain 0.0097
Further Details:      
 
Domain Number 2 Region: 405-467,495-525
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000000691
Family Filamentous hemagglutinin FhaB, secretion domain 0.072
Further Details:      
 
Weak hits

Sequence:  WP_015784299.1.62203
Domain Number - Region: 522-602
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000104
Family Filamentous hemagglutinin FhaB, secretion domain 0.051
Further Details:      
 
Domain Number - Region: 625-696
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0879
Family Filamentous hemagglutinin FhaB, secretion domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015784299.1.62203
Sequence length 952
Comment filamentous hemagglutinin family outer membrane protein [Cyanothece sp. PCC 8802]; AA=GCF_000024045.1; RF=na; TAX=395962; STAX=395962; NAME=Cyanothece sp. PCC 8802; strain=PCC 8802; AL=Complete Genome; RT=Major
Sequence
MGDITLTTKILETIPNYPVMSASFYLTPHDLLATFLSISGLMVSPIASAQVASDGTVQTQ
VNTLGNQLEITEGTQAGSNLFHSFSQFSVPSGFEAYFNNSSTISNIISRVTGGSISNIEG
LIRANGTANLFLINPNGIVFGPNAVVDIGGSFLATTAESIQFADGSQFSATNSQSSPILT
IAVPVGLQFGSNPGTIVNRAHRTVPDPTPDNPNNTRQVGFEVKSGNTIALVGGDLDFQGG
RVNGSGGRVELGSVGGNSRVQLSVTNPGLEIDYQGVTNFQDISLSQQSIVDVNNSTIQVQ
GSNIRLTNGSQISSTTRTTEDAGDLTVNATESVELIGAAPEGFPFPSAFIAQVNPGGTGR
GGNLIINTKQLSIREGAGISVASQGEGIGGRLEVNVSEAIEITGTGRLFPSVLTSSTDGT
GDGGEIVINTRQLTLSNGGQIQAFTISQGRGGTITINASDSIEVSGRGALPEFNTESFSS
ITAESGFQLLGFTGIAPGGNVNINTNQLIVTDGGTISAGSFGQGNAGSVDITSNSIFLDN
QGVITASSEGSGDAGNITILTDQLSVNNQSEISVRNIGFGQGGNLTISADAISLNQDSQL
TAVSFPLEDLTLQELGINAEEFVNRPNIGNAGDLILNTSSLNLNNDSQVTVSSFGTGNAG
SMGITAQNIALDNSSELAAETASGEGGNISLYVSDFLNLRRASTISTTAGTLGGGGNGGN
IFIDAEFMVTVPTENSDIIANAFLGNGGNIRINASGVFGIEERERLTPLNDITASSQFGQ
VGSIGINRPDVDPQRSLVKLPGEVVDAKNLVVQACSPGGAYTRGEFSITGSGGLPVNPDE
GIQTSPGLTELGYPEIEMFNQSDNQESLKIPNESLTPDYKRQSSPTTIVEAQGWIMDKNG
KVVLTAQSPNVTPHGSGFMPSNCYDLSNRSLSSATSPSPSLSDVPQRNSLAE
Download sequence
Identical sequences 395962.Cyan8802_2674 WP_015784299.1.62203 gi|257060481|ref|YP_003138369.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]