SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015791493.1.34365 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015791493.1.34365
Domain Number 1 Region: 273-552
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 1.86e-146
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.00000000114
Further Details:      
 
Domain Number 2 Region: 4-272
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 5.89e-145
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00000000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015791493.1.34365
Sequence length 553
Comment methyl-coenzyme M reductase subunit alpha [Methanocaldococcus fervens]; AA=GCF_000023985.1; RF=representative genome; TAX=573064; STAX=83171; NAME=Methanocaldococcus fervens AG86; strain=AG86; AL=Complete Genome; RT=Major
Sequence
MEAEKRLFLKALKEKFEEDPKEKYTKFYIFGGWRQSARKREFVEVAQKLIEKRGGIPFYN
PDIGVPLGQRKLMPYKVSNTDAIVEGDDLHFMNNAAMQQFWDDIRRTVIVGMDTAHAVLE
KRLGVEVTPETINEYMETINHALPGGAVVQEHMVEVHPGLVWDCYAKIFTGDDELADEID
KRFLIDINKLFPEEQAEQIKQAIGKRTYQVSRVPTLVGRVCDGGTIARWSAMQIGMSFIT
AYKLCAGEAAIADFSYAAKHADVIQMASFLPARRARGPNEPGGIFFGVLADIVQTSRVSD
DPVEQSLEVVASGAMLYDQIWLGGYMSGGVGFTQYATATYTDDILDDFSYYGYDYITKKY
GGCNSVKPTMDVVEDIATEVTLYGLEQYDSFPALLEDHFGGSQRAGVTAAAAGITTALAT
GNSNAGLNGWYLSQILHKEYHSRLGFYGYDLQDQCGAANSLSFRNDEGSPLELRGPNYPN
YAMNVGHQGEYAGITQAAHSARGDAFALNPLIKVAFADPSLVFDFRYPRKEFARGALREF
EPAGERDPIIPAH
Download sequence
Identical sequences C7P874
WP_015791493.1.34365 gi|256810887|ref|YP_003128256.1| 573064.Mefer_0938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]