SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015792225.1.73754 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015792225.1.73754
Domain Number 1 Region: 134-353
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.14e-38
Family PHB depolymerase-like 0.032
Further Details:      
 
Domain Number 2 Region: 413-517
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 5.02e-33
Family Cellulose-binding domain family II 0.0001
Further Details:      
 
Domain Number 3 Region: 29-115
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00000000000000395
Family PHB depolymerase-like 0.017
Further Details:      
 
Domain Number 4 Region: 323-408
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000118
Family Cadherin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015792225.1.73754
Sequence length 518
Comment esterase [Catenulispora acidiphila]; AA=GCF_000024025.1; RF=representative genome; TAX=479433; STAX=304895; NAME=Catenulispora acidiphila DSM 44928; strain=DSM 44928; AL=Complete Genome; RT=Major
Sequence
MLRSRSVKTRLLGLFAAVAAAVAVSLPAAPQAAAASLTQVTNFGTNPSNLAMYVYVPNNV
KPNPSILLAMHGCQGTASYMYSSTDFGKLADQYGFIVIYPQTNPSGSCWDVSSDQALKRN
GGSDPVGLMSMITYTEQHYGGNANSVFVTGESSGGMMTNVMLADYPDVFKAGAAFMGVPY
HCFYTGSVRGWNSPCANGQVSMTAQQWGDLVRNDGDPGYTGPRPRMQLWHGTADTTLNYN
NLGEEIKQWTNVDGVSQTPSSSDTPVANWNRTRYNNASGTTQVEAYSIVGAGHQLPIQGT
QMAAYAIHFMGLDGSGTTTGNTVTVTSPGNQSATVGTAISAVQVHATDSATGQSLTYSAT
GLPAGLSISSSGLISGTPTAAGTSTSTVTATDGTGASGSATFTWTVSGGGGTTPGTCHVA
YTRTNEWPGGFTANVTITNTGTAAINGWTVGWSFPGDQKITNAWSATATQSGAAVSAANV
AYDATIAPGANTSFGFQGTFTANDTSPSSFTVNGAACS
Download sequence
Identical sequences C7QAJ7
gi|256392773|ref|YP_003114337.1| 479433.Caci_3591 WP_015792225.1.73754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]