SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015792349.1.73754 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015792349.1.73754
Domain Number 1 Region: 184-520
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.38e-53
Family beta-glycanases 0.0021
Further Details:      
 
Domain Number 2 Region: 44-147
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.37e-24
Family Cellulose-binding domain family II 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015792349.1.73754
Sequence length 525
Comment cellulose-binding protein II [Catenulispora acidiphila]; AA=GCF_000024025.1; RF=representative genome; TAX=479433; STAX=304895; NAME=Catenulispora acidiphila DSM 44928; strain=DSM 44928; AL=Complete Genome; RT=Major
Sequence
MRHPFSLFRSARSRAVSAVAAVAVITIAGAGAVVALPRAAQAAGATQCQVLYSVANDWGS
GFSTNVSITNLGAPWTSWTLGYSYAGNQTLSSGWNGSWTQSGKAVTVTSMSWNGAVATNG
TVTPAANFTYSGANAAPTAFTVNGVLCGGPGSPPPTSTPSTSPSTSPSSTPSTPPSSPPP
GTPAPQLHVSGNHLVTSAGATYRLLGVNRSSGEFACVQGKGMWDGPADQATIDAMKTWNI
HVVRIPLNEECWLGNSDVPAGGTVGAAYQKAVKDYTDLLVANGINVILDLHWTYGQYTGP
SSACADALAACQKPMPDAQYTPTFWKQVATAFKGDNAVLFDLFNEPYPDAANNFSNATEA
WTCLRDGGTCTGITYPVAGMQSLVDAVRATGATNVVMTGGLTWTNDLSQWLAYEPKDPTG
NLVASWHSYNFNGCITTSCWNSTIGAVAAKVPVQAGEIGQNNCNHDYIDQVMAWADANGV
GYSAWTWNPWGVCNSNGNDLITDWSGTPTATYGQGYQAHLLTQKP
Download sequence
Identical sequences C7QC01
479433.Caci_3718 WP_015792349.1.73754 gi|256392897|ref|YP_003114461.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]