SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015793984.1.73754 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015793984.1.73754
Domain Number 1 Region: 7-270
Classification Level Classification E-value
Superfamily Cgl1923-like 1.11e-82
Family Cgl1923-like 0.0000775
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015793984.1.73754
Sequence length 302
Comment PAC2 family protein [Catenulispora acidiphila]; AA=GCF_000024025.1; RF=representative genome; TAX=479433; STAX=304895; NAME=Catenulispora acidiphila DSM 44928; strain=DSM 44928; AL=Complete Genome; RT=Major
Sequence
MIEFDGNMPDLVDPVAICAFEGWNDAGEAASNAVKHLAEAYAGAGRMFAALDGEDYYDYQ
VHRPMVAAVDDRRQVIWPTTRFSVVRAPARLLPGDAHEEPRDLVLVHGVEPNMRWRSFCE
EVLGLARDLGVGQIITLGAYLADVPHTRPTPVTGTSSDEAYQALFDVEPPTYEGPVGITG
VFQEACHHAGIPLMSFWAAVPHYVAHPPVPKATLALLRRLEDVLDLSVPTKRLAEEAQSW
EAGVDELAENDAEVGEYVRTLEEQRDNEDAADSPEASGEAIAREFERYLRRQERRRGSSE
EG
Download sequence
Identical sequences C7Q9A9
gi|256394532|ref|YP_003116096.1| 479433.Caci_5396 WP_015793984.1.73754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]