SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015798713.1.72805 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015798713.1.72805
Domain Number 1 Region: 68-168
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0000000418
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015798713.1.72805
Sequence length 252
Comment hypothetical protein [Acidimicrobium ferrooxidans]; AA=GCF_000023265.1; RF=representative genome; TAX=525909; STAX=53635; NAME=Acidimicrobium ferrooxidans DSM 10331; strain=DSM 10331; AL=Complete Genome; RT=Major
Sequence
MRRGTRTIAIAAVVVLVGGGTALAIGVRSSPPTVPRSRSHPSASTAAARTTQGVAITGAP
TPDHVSTVQDVICSGATCVAVGSSPSGDPLMWWSSDGGATFQPSEATIPADVTLNGVTCQ
EQTCVATGLASAPPPAGTPVAFASTDGGRSFTPTTLPEGAGGDGLACSRSLCVLAELPLG
TGGVGSVLVASHPLGPWTQLYLSFAPAASPTAPTTNILRSSGLAACAEDGPCLVANEVTT
IMALRTSPPCGH
Download sequence
Identical sequences C7LZR9
gi|256372076|ref|YP_003109900.1| 525909.Afer_1297 WP_015798713.1.72805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]