SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015911666.1.51754 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015911666.1.51754
Domain Number 1 Region: 10-187
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-41
Family Beta-D-xylosidase C-terminal domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015911666.1.51754
Sequence length 210
Comment hypothetical protein [Streptococcus uberis]; AA=GCF_000009545.1; RF=representative genome; TAX=218495; STAX=1349; NAME=Streptococcus uberis 0140J; strain=0140J; AL=Complete Genome; RT=Major
Sequence
MKVYDSKEMVWTREPKSFSISNQEIVIETQPHTDLWQRTYYHFQNDNAPLLQMTIEDDYF
SFVVKTTFNSKHRFDQCGLVMYLDSENWLKASIEYENEDFQHLGSVVTNQGYSDWATTEI
DASIKEMWYRLSRRGNDFRLECSQDGQTFKQMRICHMAKATGPIQCGIYACSPEDSSFTA
RFTDLQVLECQWPSHDGQAPDEVVSSITNL
Download sequence
Identical sequences B9DV03
218495.SUB1344 WP_015911666.1.51754 gi|222153467|ref|YP_002562644.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]