SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015924044.1.20074 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015924044.1.20074
Domain Number 1 Region: 156-306,337-443
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.43e-47
Family Extended AAA-ATPase domain 0.0017
Further Details:      
 
Domain Number 2 Region: 460-627
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.18e-40
Family ATP-dependent protease Lon (La), catalytic domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015924044.1.20074
Sequence length 639
Comment ATP-dependent protease, Lon family [Halothermothrix orenii]; AA=GCF_000020485.1; RF=representative genome; TAX=373903; STAX=31909; NAME=Halothermothrix orenii H 168; strain=H 168; DSM 9562; AL=Complete Genome; RT=Major
Sequence
MSFLDGLFSKDDNKIKKADKKEKELKVLYKKANDYYGKEQFILKAGKVNALDLISSSKLF
DKLTALERIIYEDPTIQVGKGNFEERILKLEDKIADMLAERSVEKDIEEQIAERMEKRQR
EYIKEIKKEIVNDDPPDNPETLRRLARLEKLDARSLNKSVIDLVRPKSLDEIVGQQRALK
ALVSKIASPYPQHVILYGPPGVGKTTAARLALEEAKKRQNTPFYGDSKFVEVDGATLRWD
PREVTNPLLGSVHDPIYQGAKKVLAEGGVPEPKTGLVTEAHAGILFIDEIGELDPMLQNK
LLKVMEDKRVKFESSYYDKNDENIPLYIKKLFEEGAPADFILIGATTRSPSKINPAFRSR
CAEVFFNPLSREDIQQIVINAVKKLTVKIEDEIPEIISEYTTEGRTAINLLIDAYSLVLY
ENEGADEQELIITRDKLFEAIQNRRMIPHNKIKSSEKSEIGKVFGLGVNGYLGTVIEIEA
VAFTAEEKGNGKLRFNETAGKMAKDSLFNAAAVIRKITGKKMKDYDLHVNIVGGGNVDGP
SAGIAMLLALISAIEEVPLKQDIAVTGEVSIRGNIKPVSGIREKIYAAEQAGMREVLVPA
ENMIDIQEDWDIKVTPISTVEEALKRVLIDQDQLKLSII
Download sequence
Identical sequences B8D1C4
373903.Hore_23310 WP_015924044.1.20074 gi|220933163|ref|YP_002510071.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]