SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015924275.1.84728 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015924275.1.84728
Domain Number 1 Region: 33-658
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 0
Family Cellulases catalytic domain 2e-17
Further Details:      
 
Domain Number 2 Region: 663-720
Classification Level Classification E-value
Superfamily Type I dockerin domain 7.06e-16
Family Type I dockerin domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015924275.1.84728
Sequence length 722
Comment endoglucanase [[Clostridium] cellulolyticum]; AA=GCF_000022065.1; RF=representative genome; TAX=394503; STAX=1521; NAME=[Clostridium] cellulolyticum H10; strain=H10; ATCC 35319; AL=Complete Genome; RT=Major
Sequence
MSKNFKRVGAVAVAAAMSLSIMATTSINAASSPANKVYQDRFESMYSKIKDPANGYFSEQ
GIPYHSIETLMVEAPDYGHVTTSEAMSYYMWLEAMHGRFSGDFTGFDKSWSVTEQYLIPT
EKDQPNTSMSRYDANKPATYAPEFQDPSKYPSPLDTSQPVGRDPINSQLTSAYGTSMLYG
MHWILDVDNWYGFGARADGTSKPSYINTFQRGEQESTWETIPQPCWDEHKFGGQYGFLDL
FTKDTGTPAKQFKYTNAPDADARAVQATYWADQWAKEQGKSVSTSVGKATKMGDYLRYSF
FDKYFRKIGQPSQAGTGYDAAHYLLSWYYAWGGGIDSTWSWIIGSSHNHFGYQNPFAAWV
LSTDANFKPKSSNGASDWAKSLDRQLEFYQWLQSAEGAIAGGATNSWNGRYEAVPSGTST
FYGMGYVENPVYADPGSNTWFGMQVWSMQRVAELYYKTGDARAKKLLDKWAKWINGEIKF
NADGTFQIPSTIDWEGQPDTWNPTQGYTGNANLHVKVVNYGTDLGCASSLANTLTYYAAK
SGDETSRQNAQKLLDAMWNNYSDSKGISTVEQRGDYHRFLDQEVFVPAGWTGKMPNGDVI
KSGVKFIDIRSKYKQDPEWQTMVAALQAGQVPTQRLHRFWAQSEFAVANGVYAILFPDQG
PEKLLGDVNGDETVDAIDLAILKKYLLNSSTTINTANADMNSDNAIDAIDYALLKKALLS
IQ
Download sequence
Identical sequences P37698
WP_015924275.1.84728 gi|220928179|ref|YP_002505088.1| 394503.Ccel_0729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]