SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015924297.1.84728 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015924297.1.84728
Domain Number 1 Region: 179-519
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.7e-66
Family beta-glycanases 0.0001
Further Details:      
 
Domain Number 2 Region: 510-575
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000000981
Family Type I dockerin domain 0.0017
Further Details:      
 
Domain Number 3 Region: 62-165
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000204
Family F-box associated region, FBA 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015924297.1.84728
Sequence length 577
Comment glycoside hydrolase [[Clostridium] cellulolyticum]; AA=GCF_000022065.1; RF=representative genome; TAX=394503; STAX=1521; NAME=[Clostridium] cellulolyticum H10; strain=H10; ATCC 35319; AL=Complete Genome; RT=Major
Sequence
MDKNNFLKVFLVLALAALIPLIPAANVPANAMLEEGIKYEFENGVQKNAEIHTDYVGKTD
DGLTFDLSGATCSFIGQKGTSTSVNVDIDQTGLYELVVRYAQPYDKTKKVQYLNVNDSNQ
GEVSFPYTLSWREMSAGIVKLNKGTNNIEFEGYWGYTFFDYLIVKPADESITSLKVEKKL
VNPDATKEAKALMSYLVDMYGKHIISGQQELCGSHNYEESEAEFTYIKDKTGKMPALRGF
DFMNYRGNGLSWDDLCAERVIDWYKNKGGIPTVCWHWFSPANIGKKADNSFYTESTTFSI
SKALTPGTAENTALLNDIKTMSEKFKQLQDAGVPVLFRPLHEAEGGWFWWGAEGPENCVK
LYRLLFDKFTNEYNLNNIIWVWTSYTYDTSSKWYPGDDVVDILGYDKYNAKDGLPNGSAI
SSTFYNMVKLTNGKKLVTMSENDTIPQVSNLTNEMAGWLYFCPWYGWHLTGEQNNPVDWL
KQMYTSDYCITLDELPDLETYPFPSDGDIPTIMYGDLNEDKLIDAIDLALLKKCILENNQ
SLKSADVDGNGSVDAIDFVYMKKFLTGEISGFPASGK
Download sequence
Identical sequences Q0PRN0
WP_015924297.1.84728 gi|220928201|ref|YP_002505110.1| 394503.Ccel_0752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]