SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015924616.1.84728 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015924616.1.84728
Domain Number 1 Region: 29-95
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.1e-17
Family Type I dockerin domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015924616.1.84728
Sequence length 621
Comment spore coat protein CotH [[Clostridium] cellulolyticum]; AA=GCF_000022065.1; RF=representative genome; TAX=394503; STAX=1521; NAME=[Clostridium] cellulolyticum H10; strain=H10; ATCC 35319; AL=Complete Genome; RT=Major
Sequence
MKKSRLLLLLSAIALVTCLFSMSFVGAATVYGDLNSDSSVDSIDYSIMKGYLFGSVTISN
PAAADVNGDGNIDAIDLALMKQYILHIITKFPADNNTTPGDNTPAAQLTGDIVFSAPSGT
FSNQVSVSLNSKIAGAQIRYTVDGSVPTASSPAYTSPLSFTRTTQLRAQSFVNGTPSGKM
GTAIYVSSAIDTKHDLPVLILDAYGGGKPAREYKDVAIMLMEPKNNEVSLLQTPTVATRA
GFHVRGQSSANFEKTPYRLELWDNQNEDAKYSLLGMPGDGDWALLSPFPDKSLIRNALAY
ELGTTMGLKAPRYRFVEVYLNLDNQPLSSADYQGVYLLTETLEIDKDRVNIKKLKDDDLT
EPNITGGYLMQFNMMATDGPLVKGSGWNDLEIKDPDDLLPQQLTWISNYIQKVHNSIRST
NPSDPTTGYPAYIDVDSFINYIIENELAREGDSYMRSTYIYKDRGAKLAAGPVWDYDLGY
NCVTGMMGMQTNYVEGWQFQPMFGMSSTCDWYYKLMQDSAFQSKISARWQELRNGPLSDT
QIKALVQKLTTPLANGAKRNFQKWNNLGTATVGGFSTQTTQTWEEQVTILQNFLLQRAAW
LDKSGWKPTTNTNPGWPGWGG
Download sequence
Identical sequences B8HZW0
gi|220928531|ref|YP_002505440.1| WP_015924616.1.84728 394503.Ccel_1101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]