SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015924716.1.84728 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015924716.1.84728
Domain Number 1 Region: 38-474
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 4.19e-77
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.000000444
Further Details:      
 
Domain Number 2 Region: 526-803
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 2.09e-31
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0000514
Further Details:      
 
Domain Number 3 Region: 808-873
Classification Level Classification E-value
Superfamily Type I dockerin domain 6.02e-16
Family Type I dockerin domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015924716.1.84728
Sequence length 873
Comment cellulosome protein dockerin type I [[Clostridium] cellulolyticum]; AA=GCF_000022065.1; RF=representative genome; TAX=394503; STAX=1521; NAME=[Clostridium] cellulolyticum H10; strain=H10; ATCC 35319; AL=Complete Genome; RT=Major
Sequence
MKIRNIKKIIILCLLIAFTCTSLLVPPVSANGPVSAPYNWNNVKIGGGGGYVCGIVYNPT
EKGLVYARTDMGGAYIRNKQTLEWEPITDWVSPDEWNLLGCESIATDPVDTNRVYIAAGT
YTNSWTQMNGYILRSEDYGKTWERTELPFKFGGNMPGRSVGERLMIDPNSNNILYFAARS
GNGLWKSTDYGKTWAKVSSFTNVGNYVEDPKFEYSSDNLGLCFVTFDSYKGTKGTPTKDI
YVGVADKKNPLYVSHDAGETWNPVEGQPTESTFTQHNSKALKIGIPQHAVVSSKGILYVT
YCDRGGPYQCDDGAVYKYDTNTGVWTDITPPSGKNWDGSPKYENYYGFSGLSVDAQNPDT
LIISSLQSWWPDNFIFRSRDAGETWDAIWEHGESYPSRNLKYTMDISKAPWLTFGNKINA
ASGGLIKGDEIMNYPAPKLGWMMSALAINPFDSDEMMYGTGATIYGSKNLTDWDSGKLVN
IEVMGMGVEETAVLSLICPPISGVELISGVGDICGFIHKDLKVGPDMMMLTPRFTSTTGL
DYAELNPKTIVRVGNTDKEQYEMIKKSVAISKDGGATWAEVQPNISYTFPASTEDDIIQG
GTVAVSADGSTFVWSTGTSQGVVCFLNGGWKAVSTLPAGANVCSDRVNPKVFYAYAENTF
YSSNDGGQTFTAVKTDLESSTSKIKAVPNKEGHVWIPGSTTGLSYTTDGGKTINKVNDIT
RSDVVGFGKAKDGEDYLAIYMCGEKDGLYAVYRSDDMAKSWVRVNDDQHQYGSINYSITG
DLRVYGRVFVATNGRGIVYGEPNSDSPTPTIGDINEDGLVDALDFAALKRYLLSSTTLTD
KQLIAADVNRDGSVNAIDLAVFKSYLLGIITSF
Download sequence
Identical sequences B8I0I9
WP_015924716.1.84728 394503.Ccel_1207 gi|220928635|ref|YP_002505544.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]