SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015924751.1.84728 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015924751.1.84728
Domain Number 1 Region: 31-335
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.28e-70
Family Pectin methylesterase 0.0000082
Further Details:      
 
Domain Number 2 Region: 497-551
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000053
Family Type I dockerin domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015924751.1.84728
Sequence length 560
Comment pectinesterase [[Clostridium] cellulolyticum]; AA=GCF_000022065.1; RF=representative genome; TAX=394503; STAX=1521; NAME=[Clostridium] cellulolyticum H10; strain=H10; ATCC 35319; AL=Complete Genome; RT=Major
Sequence
MKRERFFQLALIFVFVFQTIVGSFLMSKVGAVSYDLIVAKDGSGNYTTVQAAINSAPSNS
QTRTKIYIKNGTYKEKINISSSKINISLIGQSKAGTILTYNDAASTKTSSGGTLGTTGSA
SVTIAGNGFQAENITFENSYDEKAYGNSQAVAVLAKADKMIFKGCSFKGNQDTLYANGDA
RRQYYYNCYIEGDVDFIFGSANAVFDSCEIFSLNRSGGCITAPSTKANQKGYLIYKCKLT
SSSSPKTIYLGRPWIPSSDTVQTTPKVLYRECELGSHITDTGWTVMSGNDPANFEMWEYN
NTGTGANTYRKQLPSVKAADYTIEKFLSGSDGWNPNIDSNTPVPIPDGQYIKSLVINDTV
NAVNWSVQSNLQVGDIIYGDRTYKFTQVPQKLLGSEWIKTACNSKIYTSDLASFTAKSDV
TVYIGLDTRVTSIPGWLSSWTDTGESLVSDNSSVAYNIYKKDFMAYSLVTLGTNGASSST
VNYAVIVKSNTYDFLLGDANGDGEVNSLDYATLKSYLLGKISLSQEAMKTVDFNNDNTID
AIDLALFRINLLGGPIYNML
Download sequence
Identical sequences B8I0M7
394503.Ccel_1246 gi|220928673|ref|YP_002505582.1| WP_015924751.1.84728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]