SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015979355.1.13133 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015979355.1.13133
Domain Number 1 Region: 12-139
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 1.03e-48
Family N-acetylmuramoyl-L-alanine amidase-like 0.00000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015979355.1.13133
Sequence length 151
Comment lysozyme [Methanosarcina mazei]; AA=GCF_000979195.1; RF=na; TAX=2209; STAX=2209; NAME=Methanosarcina mazei; strain=1.H.A.2.3; AL=Scaffold; RT=Major
Sequence
MARVQFKQRESTDAIFVHCSATKPSQNVGVREIRQWHKEQGWLDVGYHFIIKRDGTVEAG
RDEMAVGSHAKGYNHNSIGVCLVGGIDDKGKFDANFTPAQMQSLRSLLVTLLAKYEGAVL
RAHHEVAPKACPSFDLKRWWEKNELVTSDRG
Download sequence
Identical sequences A0A0F8RKH4 D1LVD8 P00806 Q3V7D1
gi|9627445|ref|NP_041973.1| cath|current|1aroL00/1002-1150 1aroL NP_041973.1.42730 WP_015979355.1.13133 D1LVD8_BPT7 NAAA_BPT7 Q3V7D1_BPT7 1aro_L

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]