SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_016357724.1.92605 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_016357724.1.92605
Domain Number 1 Region: 61-212,347-504
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.26e-52
Family Tandem AAA-ATPase domain 0.0001
Further Details:      
 
Domain Number 2 Region: 565-691
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 2.36e-32
Family XPF/Rad1/Mus81 nuclease 0.0000431
Further Details:      
 
Domain Number 3 Region: 705-773
Classification Level Classification E-value
Superfamily RuvA domain 2-like 7.31e-17
Family Hef domain-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_016357724.1.92605
Sequence length 788
Comment Hef nuclease [Methanobrevibacter sp. AbM4]; AA=GCF_000404165.1; RF=na; TAX=224719; STAX=224719; NAME=Methanobrevibacter sp. AbM4; strain=AbM4; AL=Complete Genome; RT=Major
Sequence
MANFINHPLLRKDKVESRIYQKVLAANALKKGNTMIVAPTALGKTIVAVLVAADRLNNLK
GSKVLVLAPSKPLTIQHEDSFREFLNVPVCSITGSIKPEEREKRWNESSVICATPQTVES
DLLKGRYNFEDVSLIVFDECHHGVGSYSYVYLANRYIQERENHLILALTASPGHDKSKIK
EVCDNLFIQDVVVKTEEDPDVRPYFNPIKIDWVPIELGNELTKIQEALKKSLKTRLKALK
NMKVINSITVNKRDILKARGKVQNKIATTTNPPKECFQAISILTAVINLQHGIELIETQG
VVPFNDYVNRLEKKKTKASKNLFIDHNFQRAVRLSRIAEEHGHEHPKLKKLTDILKKELG
YDDGQTTLKSLRSVEDSKKSRQSPKILVFTQFRDTLEMIRQKCEDEGIKAVKFYGQGTRN
GEKGLTQKQQHEIIKSFKVGTYDVLLSTSVAEEGIDIPAIDLVVLYEPVPSEIRMIQRRG
RTGRKHQGKMKVLVTKGTLDEAYFWSAKRKEKNMKHQLIDNELFSNLNLNAVERIESVRN
IKSVDNLNEVNKEEDKLDNNNKRKKVVVYADSREGNSRVIRNLDTIGVDVEIKTMTVGDY
QISDDIIIERKTAKDFTDSIVDKRLFKQATLMREEFKKPLMILEGNDFYTGFINPNAIRG
AMASIAIDFGISIIPTRGPDDTAAMIKRIAIKEQKGKSQPIQIRTERKPDNLWEQQQFIV
ESLPNVGPVTAKNLLKHFGSVKAVVNASEDDLQEIEGIGKRTAENIHKVLASKYLYFEKS
DSKNKKLM
Download sequence
Identical sequences R9SIU3
WP_016357724.1.92605 gi|509154225|ref|YP_008074465.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]