SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_017294375.1.8520 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_017294375.1.8520
Domain Number 1 Region: 441-543
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.58e-23
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.075
Further Details:      
 
Domain Number 2 Region: 370-417
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000301
Family HAMP domain 0.0043
Further Details:      
 
Domain Number 3 Region: 619-825
Classification Level Classification E-value
Superfamily PP2C-like 0.0000366
Family PP2C-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_017294375.1.8520
Sequence length 827
Comment hypothetical protein [Geminocystis herdmanii]; AA=GCF_000332235.1; RF=representative genome; TAX=113355; STAX=669359; NAME=Geminocystis herdmanii PCC 6308; strain=PCC 6308; AL=Chromosome; RT=Major
Sequence
MSKKIYPRTNLRNLLVFPFVCQILAILAIISYLSYRSAKKALSEITLDLRSEIAFNIDNY
LEDYFTEGNQLNQINRNAIILNPLLFENLDLLGRYFVSQYQWTSNIDKIAFADAKQGNYI
EVLKTPSGDFELTILERNKSKDLLTYQLNSQGEITKLLRKEHNYNFDSRQLFWYQNTLKN
NQSQWHEIYKDYVNQELLAFVSKTVYDNNNNFLGVLTNQQNLIDISEFLRDIKIGKTGLA
FILDRNGILMADSLNKHLNNKFEDTDLLTSGTNNKNQYIYRITNFLQSNNVLSQSNKKPI
NFELNINNNKLLTKVININNNSGINWFVVLVIPESDFMIFIRENTRLTITLSFIALIFAI
SSGLITSKFLIQPIIKLKIASQKISEGEFNQKVPLQGIEELDSLAMSFNNMSQMLEAFFD
HLNKSLQDVSNLKYAIDQSAIVTLTDPNGKIIHSNEKLTEISGYSSEELIGQKTSKFKSG
YHDKKFYKSMWLTISKCQVWRGEIKNKGKDNHYYWVDTTIVPLTDEKGHILQYLSIQTEI
TERKILEKNLEKIVDIRTQELANANEEINLLNQRLCSENILLSDKLKILHEMQELILPKN
EELKQIKCLDIVAYMQPMDELGGDYYDVLEYDDVITIGIGDVTGHGLESGMLMLMTQAAI
CTLKQRGETNPVEFLNTLNKAIYHNIQRMKSAKNLSLAILNYADNQLRISGQHEEVIFVR
KGGKIELIDTIDLGLPIGLDYDITEFIDHKLITLNQGDGIVLYTDGITEARNVDKMQYGI
ERLCNVVSQNWHLDIESIKDIIIDDVKKFIGLNKISDDITLLLLKQK
Download sequence
Identical sequences WP_017294375.1.8520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]