SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_017701508.1.7489 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_017701508.1.7489
Domain Number - Region: 43-137
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00366
Family Pseudo ankyrin repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_017701508.1.7489
Sequence length 269
Comment hypothetical protein [Pseudomonas syringae]; AA=GCF_001497455.1; RF=na; TAX=1674924; STAX=317; NAME=Pseudomonas syringae pv. actinidifoliorum; strain=CFBP8161; AL=Contig; RT=Major
Sequence
MEAEQVWKLWRHVLRDERLQAQLFSATDATHWLSGFSESESEILSVYAQQFDRVKWFVEN
YQFRLVNSFLNALETGAPLSLRALLHINVDLNAQSKAFLRDRQWRDYGPQVYTYCDDVLG
FLAEADELQGYPEILDLMRLERESVRLYRGLVDPESLPADNRYHRTSMARLYETRFALSG
WLRQKDQLGLTRLPESTEQVLIYLPTLQARHKFTLINAQAARLYNCLEQPQSAARLFMLI
NSDSASVPGSADLALLDRLEQLNAIRKPL
Download sequence
Identical sequences A0A0W0PLD3
WP_017701508.1.101050 WP_017701508.1.15002 WP_017701508.1.18573 WP_017701508.1.20801 WP_017701508.1.42260 WP_017701508.1.43547 WP_017701508.1.49930 WP_017701508.1.59377 WP_017701508.1.60335 WP_017701508.1.7489 WP_017701508.1.79551 WP_017701508.1.8158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]