SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_018278710.1.39465 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_018278710.1.39465
Domain Number 1 Region: 6-65,97-144
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000157
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_018278710.1.39465
Sequence length 151
Comment SMI1/KNR4 family protein [Capnocytophaga cynodegmi]; AA=GCF_000379185.1; RF=representative genome; TAX=926551; STAX=28189; NAME=Capnocytophaga cynodegmi DSM 19736; strain=E6447; AL=Scaffold; RT=Major
Sequence
MNTHFLKEIENKLNITFPESYKKLMSEFESFCVLEYREKEIDIRNINRLSSSIDTKSDLQ
EWQYLQQWTQDNTHKQPKPELVKRNDSSETLPRERVANGFLFADGSDGVRLYFDIQDNMS
VWKYWLDEGSVGKIADCFDELLSKSEIVEQE
Download sequence
Identical sequences A0A0B7HAD2
WP_018278710.1.29325 WP_018278710.1.39465 WP_018278710.1.60294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]