SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_018279711.1.60294 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_018279711.1.60294
Domain Number 1 Region: 36-159
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.31e-18
Family SMI1/KNR4-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_018279711.1.60294
Sequence length 197
Comment SMI1/KNR4 family protein [Capnocytophaga cynodegmi]; AA=GCF_000827735.1; RF=na; TAX=28189; STAX=28189; NAME=Capnocytophaga cynodegmi; strain=Ccy74; AL=Contig; RT=Major
Sequence
MFEINKKEDVIIPFEKIGDENWEKNTRFILTADGDELPEVVTEEEIQEVEKRLGAKLPDS
LKLFYKTFGVADIGEELIDLDSISYLVEYLGEDNEYDSEFSEEDKEALPYLVWFGDYLGN
GNKFCFHTKTHEIYYFDHDTYPYLAKLFDDFSDYLKGCLIFKQMDYISDEKWEKFEPILE
EIVSEFINDEVIEKWRY
Download sequence
Identical sequences A0A0B7HDL1
WP_018279711.1.29325 WP_018279711.1.39465 WP_018279711.1.60294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]