SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_020117045.1.8098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_020117045.1.8098
Domain Number 1 Region: 168-371
Classification Level Classification E-value
Superfamily Lysozyme-like 2e-67
Family Family 19 glycosidase 0.00000776
Further Details:      
 
Domain Number 2 Region: 36-155
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.85e-41
Family Ricin B-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_020117045.1.8098
Sequence length 371
Comment endochitinase [Streptomyces canus]; AA=GCF_000383615.1; RF=na; TAX=1172183; STAX=58343; NAME=Streptomyces canus 299MFChir4.1; strain=299MFChir4.1; AL=Scaffold; RT=Major
Sequence
MSSSLHRGRLAVFAVLAAVLTALLTVTPAHAASGTITGLAGKCVDVAGASTANGTAVQLY
DCNGTGAQIWSNSGDGTLRALGKCLDIADRGTADGAAVQLWDCSGGANQQWVVSGARDIV
NPAANKCLDVRDNNSANGTRLQIWTCSGTANQKWNAPASGGGSTPSGFVVTEAQFNQMFP
NRNSFYTYGGLVAALSAYPGFATTGSDTVRKQEAAAFLANVNHETGGLVYVVEQNTANYP
TYCDWNQPYGCPAGQAAYYGRGPIQLSWNFNYKAAGDALGIDLLGNPWLVQNDSAVAWKT
GLWYWNTQSGPGTMTPHNAMVNQAGFGQTIRSINGSLECDGRNPAQVQSRVDAYNRFTSI
LGVTPGGNLYC
Download sequence
Identical sequences WP_020117045.1.8098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]