SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_020127500.1.25160 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_020127500.1.25160
Domain Number 1 Region: 168-371
Classification Level Classification E-value
Superfamily Lysozyme-like 1.97e-66
Family Family 19 glycosidase 0.0000101
Further Details:      
 
Domain Number 2 Region: 37-155
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.18e-40
Family Ricin B-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_020127500.1.25160
Sequence length 371
Comment endochitinase [Streptomyces sp. 303MFCol5.2]; AA=GCF_000383635.1; RF=na; TAX=1172181; STAX=1172181; NAME=Streptomyces sp. 303MFCol5.2; strain=303MFCol5.2; AL=Scaffold; RT=Major
Sequence
MHGPRSLPRFTVFAALCAVLTALFTVTPAQAADGSITGLAGKCVDVAGAGSANGTAVQLY
DCNGTGAQIWSNPGDGTLRALGKCLDVVDRGTADGAAVQLWDCSGGTNQRWAVSGAKDIV
NPAANKCLDVTGNNSANGTRLQIWTCSGGANQKWNAPASGGGGTPSGFVVTEGQFNQMFP
SRNSFYTYSGLTAALSAYPGFANTGSDTVKKQEAAAFLANVNHETGGLVHIVEQNTANYP
HYCDWGQPYGCPAGQAAYYGRGPIQLSWNFNYKAAGDALGIDLLNNPWLVQNDAAVAWKT
GLWYWNTQNGPGTMTPHNAMVNQAGFGQTIRSINGSLECDGRNPAQVQSRVDAYNRFASI
LGVSPGSNLYC
Download sequence
Identical sequences WP_020127500.1.25160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]