SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_020445034.1.31664 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_020445034.1.31664
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily Vng1086c-like 1.44e-29
Family Vng1086c-like 0.0000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_020445034.1.31664
Sequence length 92
Comment hypothetical protein [Salinarchaeum sp. Harcht-Bsk1]; AA=GCF_000403645.1; RF=na; TAX=1333523; STAX=1333523; NAME=Salinarchaeum sp. Harcht-Bsk1; strain=Harcht-Bsk1; AL=Complete Genome; RT=Major
Sequence
MHKDELLELHEQMVTIMRHFRDREDSDPALFEPYEQLDIEPDHVHKSKNEHKHAVFVLGN
ALASAMSEDEFSSAGRIGKRMEELADDAEQKI
Download sequence
Identical sequences R4VSF2
gi|510880270|ref|YP_008052938.1| WP_020445034.1.31664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]