SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_020457717.1.31213 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_020457717.1.31213
Domain Number 1 Region: 82-303
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.86e-26
Family beta-glycanases 0.014
Further Details:      
 
Domain Number 2 Region: 719-788
Classification Level Classification E-value
Superfamily Type I dockerin domain 2.16e-18
Family Type I dockerin domain 0.00078
Further Details:      
 
Domain Number 3 Region: 422-557
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.39e-18
Family Family 6 carbohydrate binding module, CBM6 0.033
Further Details:      
 
Domain Number 4 Region: 565-703
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.66e-17
Family Family 6 carbohydrate binding module, CBM6 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_020457717.1.31213
Sequence length 790
Comment dockerin [Ruminiclostridium thermocellum]; AA=GCF_000015865.1; RF=representative genome; TAX=203119; STAX=1515; NAME=Ruminiclostridium thermocellum ATCC 27405; strain=ATCC 27405; AL=Complete Genome; RT=Major
Sequence
MLVMSVMPLPKSFAANQVLTVDLAADTGEICYGAIGGLYAMGSPGVPTDNVIVPLGMKAI
SQKAPDGLQHPTGDALKVAPQFIEAGGEYVMIMMQDIYRNWPYEDLGINDYLAKIETICR
KVVADPYRHKYVYVPINEPEWIWYRGNMTKLCNEWKMMYDKIRSIDPTAKIAGPNYAVYN
SSAYRQFMTFCKNNNCLPDIVTWHELDDGFFSNWYNHYNDYRNIEKSLGISPRPININEY
GRINVDGGIPGNLVQWIARFENSKVYACLAYWTTAGTLNDLVTQNNKATGAWWLYKWYGE
LTGHTVQVTPPSLNGSLQGLAALDRNKKQARVIFGGSLRSTDVFNTDVVVKGFNSHSYFG
NSVHVIVWGVDNTGTNPSSGPYLVHEGDYNISNGQITVTVNNMKALSAYHMIITPNTDLS
PANNRNRYEAEYARILGTATVSHGGHSGYSGTGFVEGYAGSNNASTNFVVTAETDGYYNV
TLRYSAGPYPGAPKTRYLRMVVNGGLHKDVACIQTANWDTWESTTVKVFLQAGINRLDFK
AFASDESDCVNIDYIDVEPTSGTINVYEAEDPANTLGGAAVRQRDNAASGGQYVGWIGNG
SNNYLQFNNVYVPQAGTYRMVVQFANAEVFGQHSYNNNVVDRYCSISVNGGPEKGHYFFN
TRGWNTYRTDIIDVYLNAGNNTIRFYNGTSGSYAPNIDKIAIAAPFEGGTEPTPPEEDFV
YGDVDGNGTVNSTDVNYMKRYLLRQIEEFPYEKALMAGDVDGNGNINSTDLSYLKKYILK
LISAFPAETN
Download sequence
Identical sequences A3DHB2
gi|125974624|ref|YP_001038534.1| 203119.Cthe_2137 WP_020457717.1.31213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]