SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_020457759.1.31213 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_020457759.1.31213
Domain Number - Region: 31-78
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0145
Family Family 6 carbohydrate binding module, CBM6 0.057
Further Details:      
 
Domain Number - Region: 151-198
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 0.0216
Family Alpha-macroglobulin receptor domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_020457759.1.31213
Sequence length 251
Comment hypothetical protein [Ruminiclostridium thermocellum]; AA=GCF_000015865.1; RF=representative genome; TAX=203119; STAX=1515; NAME=Ruminiclostridium thermocellum ATCC 27405; strain=ATCC 27405; AL=Complete Genome; RT=Major
Sequence
MIDVYDYAKYPTKEEWMKICGDKADIINRIYLDNNGNKIEFSLSDFEDGYYNIQMQYWLK
EFNNRAFDLIVNYTLLKYYYDSGIPDEEWYKSPGENGKSVQYFPHFEKKHYGILYWFSFY
VDSYYTRFEGLIDTIYHIINIKYRLGIKPSSEFRGNVLKKLEKKDKALYKYLNSLPKNPV
YKKINKFRNNIVHNYRPNQIDSGFTRTINHEGSEIITMSVGNYTTSTEFLNNIKDSLDLL
ADITDKIRVKI
Download sequence
Identical sequences A3DHT7
gi|125974799|ref|YP_001038709.1| WP_020457759.1.31213 203119.Cthe_2314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]