SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_020458020.1.31213 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_020458020.1.31213
Domain Number 1 Region: 25-182
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000051
Family CBM4/9 0.079
Further Details:      
 
Weak hits

Sequence:  WP_020458020.1.31213
Domain Number - Region: 299-399
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000108
Family APC10-like 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_020458020.1.31213
Sequence length 968
Comment glycosyl transferase [Ruminiclostridium thermocellum]; AA=GCF_000015865.1; RF=representative genome; TAX=203119; STAX=1515; NAME=Ruminiclostridium thermocellum ATCC 27405; strain=ATCC 27405; AL=Complete Genome; RT=Major
Sequence
MSKKLFKVCLILLISIQFIFSSPVFAESENLVKNPGFEEGNDESVYFWQTHCWEKAEGVT
EFFIDESVYHSGGKSACIVNHSENDSRYMQPIKVKGDTYYRLSCWVKTENVGTKTKGANI
SIEGSLDTSRDIRETSDNWEYLELYGKTSPNQETFTLTIGLGGYGNTNTGKIWIDDVEVV
ELESLPAGKTAINLDPKYTGGNQNTSENTGGKIFMIFIALIFFLILLAVIFVIFFKDKMP
GFNAKAAQTDKPAAKKNQKDNDEKWIKVKFDKIDFIIMGVMTLVYLCVALYNLGDFKVPT
TSWEPTLPGEYFTVDLGKEATLSRIYYYCGLGSNKYNPFSKLRVEYLNENQEFEYLATID
KKELQDIFKWKYVDTAPVTTTQLKFIVDSTGGAFNEIAIVEQNSKEPLKNIKIIDSVLED
ESKATIGNLFDEPDKFAFKPSYMNGMYFDEIYHARTAFEHIHRMSPYETTHPPLGKIFIA
LGILVFGMVPFGWRIVGTLFGVAMVPVMYMFGKKVFHDRFYAFCTAFLMMFDFMHFSQTR
IATIDSYVTLFVILMYYHMYDYFINKSYNTTLKESLKPLFLSGLFFGLGAASKWIAIYGA
AGLALLFFVNKGTEFWEYRKISTGKSKKKPLWIGDYPSNLGITIGACVLFFIIIPLVIYI
LSYIPYMLVPGDNKGITVFIENSKHMFEYHSKLEAEHPYQSAWWEWPIMAKPMAFYFGSD
LEPGMTSKIFTMGNPAVWWVGLLALLIVAIFALSKVNKNLVVLFTLAATTFGYVALPKTI
FTETLKAQSAELCWAVIFFALIAILLVLSKLDTDILITSAVSSVAFGTILYLFKDIERGD
AYLKSGNTQLIIWACLLICITLLFIGIYRYDKKMMVPLAGLIFQYVPWIAVPRIAFIYHY
FSIVPFLILLIVYVIKKAADKHSGVKYFACVYLGIVMALFILFYPGLSGLEVPTSYMRYL
KWFNTWYF
Download sequence
Identical sequences A3DK11
gi|125975573|ref|YP_001039483.1| WP_020458020.1.31213 203119.Cthe_3095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]