SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_020458060.1.31213 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_020458060.1.31213
Domain Number - Region: 32-109
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0755
Family Papain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_020458060.1.31213
Sequence length 266
Comment hypothetical protein [Ruminiclostridium thermocellum]; AA=GCF_000015865.1; RF=representative genome; TAX=203119; STAX=1515; NAME=Ruminiclostridium thermocellum ATCC 27405; strain=ATCC 27405; AL=Complete Genome; RT=Major
Sequence
MPSLDWNSDRYKNIGKDETCNNEDIVKTSLTNTDFLKIVDDGKVYYGGNQNWFQKYTQSF
GGCGPTAAANILAYMAMTDPKFAKLYEYDLKNITKADFVKFMEEVYKYVTPLEVPVFSHM
SDKKGKQAGIPSLGITGLAAFAKGVEKFAKSRGIKLKAKWSGEKPTFDNAVSYIREGLRK
NRPVALLNMFNPVSMQWSDPETSKIKSMTYERHWVTITGMIENRKTGEVTLEVSTWGGKA
TLSFNELYNNMDWNEMIFPAGIIYFE
Download sequence
Identical sequences A3DKD8
WP_020458060.1.31213 gi|125975700|ref|YP_001039610.1| 203119.Cthe_3222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]