SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_020458076.1.31213 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_020458076.1.31213
Domain Number 1 Region: 24-67
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000398
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_020458076.1.31213
Sequence length 73
Comment hypothetical protein [Ruminiclostridium thermocellum]; AA=GCF_000015865.1; RF=representative genome; TAX=203119; STAX=1515; NAME=Ruminiclostridium thermocellum ATCC 27405; strain=ATCC 27405; AL=Complete Genome; RT=Major
Sequence
MKIIEDENSGEVVIDNIRIEGFIYDEKCKKCNNFLVYYEKYDAFFCAYCNEWVESKCRDK
ECEFCKSRPEKPL
Download sequence
Identical sequences G2JC86
2005471078 gi|346980504|ref|YP_004849448.1| WP_020458076.1.31213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]