SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_020462680.1.9268 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_020462680.1.9268
Domain Number 1 Region: 4-267
Classification Level Classification E-value
Superfamily Cgl1923-like 6.54e-84
Family Cgl1923-like 0.00000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_020462680.1.9268
Sequence length 307
Comment PAC2 family protein [Frankia sp. EAN1pec]; AA=GCF_000018005.1; RF=na; TAX=298653; STAX=298653; NAME=Frankia sp. EAN1pec; strain=EAN1.pec; AL=Complete Genome; RT=Major
Sequence
MLDPRELYEIRSDLDDLGRPVLIEAMTGVVDAGGAVGLASEHLTTALQHERIVTFDVDQL
MDYRSRRPPMVFYEDHWESYDDPVLAIELLHDEAGTPFLLLCGPEPDLHWKRFTKAVQAV
MAELGVRMSVGLNAIPMAVPHTRPCGVTAHATRKELLVGYEPWVRRLSVPGSAGHLLEYE
IGRSGADAMGFAAHVPHYLAQATYPAATEALLSSVSKSTGLLLPLDGLRSAALEVRGEVD
SQIARGGEAADVVKAIEEQYDAFHRGREGEHLPVVDDSEPLPTGEELGAALERFLAEQSE
PGGPQPT
Download sequence
Identical sequences A8L0N3
gi|158316964|ref|YP_001509472.1| WP_020462680.1.9268 298653.Franean1_5208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]