SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_020738412.1.94496 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_020738412.1.94496
Domain Number 1 Region: 24-93
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00000667
Family Pentapeptide repeats 0.019
Further Details:      
 
Weak hits

Sequence:  WP_020738412.1.94496
Domain Number - Region: 193-248
Classification Level Classification E-value
Superfamily FnI-like domain 0.1
Family VWC domain 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_020738412.1.94496
Sequence length 277
Comment hypothetical protein [Sorangium cellulosum]; AA=GCF_000418325.1; RF=na; TAX=1254432; STAX=56; NAME=Sorangium cellulosum So0157-2; strain=So0157-2; AL=Complete Genome; RT=Major
Sequence
MLPEDAAEEPVDADEQAAIMGNGLTFNGLTFNALTFNGLTFNALTFNGLTFNALTFNGLT
FNALTFNGLTFNALTFNGLTFNALTFNGLTFNGPVMAALSDPLGRQQLSAIVGCALPKGE
AIRLNIEGVDYSFQGSTGLAPEWGKPGGACGEDCKSWVSACVISRVNYLGQSVQISVRGK
DKALASTREEREGYTRREGAYFGDIFATPQKLHACVAPGATQIPRVCGPSIRDCSPIEVL
GACDDVCDHELGDGAFDKCRDRSGKMQKAAVTVFLAR
Download sequence
Identical sequences S4Y1X6
WP_020738412.1.94496 gi|521465653|ref|YP_008152893.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]