SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_020738488.1.94496 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_020738488.1.94496
Domain Number - Region: 7-37
Classification Level Classification E-value
Superfamily FnI-like domain 0.00586
Family Fibronectin type I module 0.013
Further Details:      
 
Domain Number - Region: 37-105
Classification Level Classification E-value
Superfamily Cyanovirin-N 0.068
Family Cyanovirin-N 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_020738488.1.94496
Sequence length 138
Comment hypothetical protein [Sorangium cellulosum]; AA=GCF_000418325.1; RF=na; TAX=1254432; STAX=56; NAME=Sorangium cellulosum So0157-2; strain=So0157-2; AL=Complete Genome; RT=Major
Sequence
MALLSGCGDSDAERIEQQRETWNEKHVTSYVVETCATGFSAGCRRVAVEDGQVVAAREKS
PNDNSPWSDIDDLTNVDEPIAWMFDRAEGTPDDCELSQLSFDPQFGFIREYYVSCSVEGS
GERVTCFAPDTVDLAACE
Download sequence
Identical sequences A0A150P4B4 S4Y062
gi|521465726|ref|YP_008152969.1| WP_020738488.1.94496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]