SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_020977741.1.23305 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_020977741.1.23305
Domain Number 1 Region: 2637-2978
Classification Level Classification E-value
Superfamily Adenylylcyclase toxin (the edema factor) 3.01e-66
Family Adenylylcyclase toxin (the edema factor) 0.00025
Further Details:      
 
Domain Number 2 Region: 2067-2204
Classification Level Classification E-value
Superfamily PMT central region-like 3.01e-32
Family PMT central region-like 0.0069
Further Details:      
 
Domain Number 3 Region: 2218-2338
Classification Level Classification E-value
Superfamily PMT central region-like 1.96e-29
Family PMT central region-like 0.0016
Further Details:      
 
Domain Number 4 Region: 2384-2543
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.24e-19
Family ADP-ribosylating toxins 0.0087
Further Details:      
 
Domain Number 5 Region: 4061-4258
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000249
Family Serralysin-like metalloprotease, C-terminal domain 0.0056
Further Details:      
 
Weak hits

Sequence:  WP_020977741.1.23305
Domain Number - Region: 3972-4061
Classification Level Classification E-value
Superfamily beta-Roll 0.000123
Family Serralysin-like metalloprotease, C-terminal domain 0.0036
Further Details:      
 
Domain Number - Region: 1460-1600
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0017
Family CBM11 0.06
Further Details:      
 
Domain Number - Region: 3494-3555,3691-3754
Classification Level Classification E-value
Superfamily beta-Roll 0.00575
Family Serralysin-like metalloprotease, C-terminal domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_020977741.1.23305
Sequence length 4339
Comment autotransporter adhesin [Vibrio anguillarum]; AA=GCF_000462975.1; RF=na; TAX=882944; STAX=55601; NAME=Vibrio anguillarum M3; strain=M3; AL=Complete Genome; RT=Major
Sequence
MGKPFWRSVEYFFTGNYSADDGNNDIVAIGFGGEIHAYGGDDHIHLGSIGATVYTGSGND
TVSAGAGYLKVEDTTGNLSVRGAAGYADIKKNGDGNLSFSGAAGGVDIGHDGQHGNISYA
GAAAYNHIKRQGSSGHVSFQGAGGYNAIWHETNHGNLSFEGAGAGNKIDRTWFNQYQGSQ
GDVRFVGAGVANSISSRVESGNLHFSGAGADNHLVRKGKVGDITLEGAGASNRIERTHNA
NDVYTETRGNIRFEGVGGYNSLYSDVAHGDIHFSGGGAYNTITRKGSGGDFDAQGMEYAK
ADEIVLTTAQMHGLSIDNGNKFHAVNAVKSEREPNTYLFAIADGNYTKINKIRLYNDAES
GKLKYYSEAWFKQGNHLTDLAHSDVSFSGGFESNPVNGGYTLSNIAIEHQQSVTVHAVEK
SLTEYEWVTYANGVVIDAKDVSLSDAKMGGHAIFADGTKVDVKAVKSNRKPNTYVYAKML
GQHTKIVVVELANDAETGALKYQARSWYKEGDHTANLANQDISSAYGYHAMGKGGYSLSD
LHYSVNAIRSTSETVADIDEYTDQTLFKPVSDSGESSGDIHFNGVGGGNVIKSNVTRGHV
YFNGGGLANVILHSSQFGNTEFNGAGAANVIVKSGEEGDLTFRGAGLANVLVHQSQQGKM
DVYAGGALNVLVRVGNGDYLARLLAYGNISVQKGQGNSRVTLLGGYNTHTQIGSGDALWL
AAGGFNVMTQVGQGDVASVLAGGANVLTKMGDGELTAGMLGGANVITHISSDDQLSNTTA
VALGGANILTKKGKGNTLAVMGGGANVLTHVGDGTTTGVMVGGANILTKVGNGDTTGIML
GVGNVLTHVGDGQTLGVMGAAGNIFTKVGDGTSISVMIGAGNIFTHVGEGNAWALMGGLG
NVFTKVGNGDALALMVAEANVFTHIGDGMSVALMLAKGNIATKVGNGTTLAAMVGNANIF
THVGSGSTFAAMIGQANIMTKVGDDLTAALMVGKANIYTHVGDGTSLGIFAGEVNVMTKV
GNGTTLAAMFGKANIMTHVGDGLTGVLALGEANIVTKVGDDFMGVVAAAKANVVTHVGDA
TTAAVLAGKGNILTKVGEGTTVGLLISDIGNVMTHVGDGTTIGIAKGKANIITKVGDGLG
VNVAWGQANVFTHVGDGDRYNFAKGEANVISKVGDGQEVSVVQGQANIITHVGDGDDYTG
AWGKANVITKVGNGRNVVLAKGEANIVTQVGDGDSFNALWSKGNIVTKVGDGMQVTAAKG
KANVTTRVGDGLNVTAAYGDANINTVVGDGISVNVAWGQYNVNTKIGDGLNVAVMKGKAN
ANIHVGDGLGVNASYAQNNVAIKIGNGDFYSLAVASSNTSSNKLSALFDNIKQTVLGVGG
SQAINYLVQGDEASSSGTHKGRGAIATPEITKLDGFQMEAIEEVGSDLGDSLTGSVTKVD
APDLNQMQNALSVDDSSDQVQGPNLIVNGDFEQGEYGWRASNGIEAGFSANGYGVASEGH
GNRVSELDTYINTTIFQDLNDLNHGEVITLSFDFAKRAGISNNEGIDVLWNGEVVFSSSG
DESAWQKKTLKLTAQAGSNRIEFKGTGHDDGLGYILDNVVAKLETLQQTNAVSEHATQNQ
ASQNALSDKERAEADRQRLEQEKQKQLDAVAGSQSQLESTDQQALENNGQAQRDAVKEES
EAVTAELTELAQGLDVLDDRATHTGESGDQWRNNFAGGLLDGVQTQLDNAKQVSGEQIAA
AKQTHADNQNKVKDSVAQSEAGVAKGEQNLAGAEQGIADAKTDAEKRKADALAKGNDAKE
AESDAHSAANDAQSRGDRDAMNAEHKANQVQNDAKGAKQNESDRPDRQGVAGSGLVGQAH
SVEAAGAAGRHINADSQTNADGRFSEGLSEQELEALEGATNAVNRLQINAGIRAKNTGSS
VTSMFTETNADSIVVPTTASQDVSCQEIHISRGDLEGLGEVSSHTVMDGNAIDNMLRDSL
PFYSLRAERNLLVQEGDEGLEVRAWPGTDDNSKIIVLDDPEDAAQQKAIERFILANFDNF
EQMPDELFLVDNKVISHHEGRTRVLAQKEEGAWKYNTKAELMSVTELLDAASVTGKIRGE
SYQQVIDALAEYNLSTFEHADYELESVEKLVNLCKQIEGYVLGHPDSGRVETMKSLLNQV
NSRLEAVSVLAVSDQSIKDHDSFSRLYDQLDNANLKNKQYLDTDSPQSAERALESLGEGK
QTTLDLSSVSTKDELKNEAKVFAKPIGESYQKILDQLDLLHTTQGDKQIEAALRLNNLVD
DYVSHHEKSGRNTALLSLKNRVSESLYNNVAEETRVEIAKLSATRIDLAADLLHRLHSST
NKVSSVVDIKHLADGTKYSSQESLAVLSKQEVPFNKELQDQQLVQGRETGEAVVNNVQLS
DDEIKGIKWYTSEGFQYVNEALRKEDKLTYFVKDNAVNAVKGLNKLETFEGTVYRAFMPG
VSLNDLASQVTPGQLFSDQGFTSTSTSTELAKSFRGGKDTVILTILDAKGTNVAGLAQLN
QAEVLLKPGAHLRIEAVKETDQNLHIVAKYTEEFHAGETVRNLFDGKTIGIAINRNTSTI
NESVITSFDHDEITTLLKNKPVLDDAETISNADSHHKNYQSRDLVLEPIVQPETIELGMP
DIDQKILAEVAERENVIIGVRPVDEKSKSLIDSKLYSSKGLFVKAKSSDWGPMSGFIPVD
QSFAKASARRDLNKFNGYAEQSIESGNAVSADLYLNQVRMDELVSKYQSLTALEFDAESG
MYKTTATNGDQTVTFFLNKVTVESKDLWQVHYMKDGELAPFKVIGDPVSKQPMTADYDLL
TVMYSYADLGPQDKVKQPLTWEQWKESVTYEDLTPKYQELYDSEVLYNKKDGASLGVVSD
RLKTLKDVINTSLGRTDGLEMVHHGADDANPYAVMADNFPATFFVPKSFFMEDGLGEGKG
SIQTYFNVNEQGAVVIRDPQEFSNFQQVAINVSYRASLNDKWNAGLDDQLFTPKRKLSHE
FLVARDKIAKMLSNESSDLGNDSELEGIAERRTVGSVINHNEAREGEQGSKVVHTIDTLP
SSEILDQVIRDLNKSSTLMSETNFYDPKKFESDSVRVKVEWKQTLTNINNIRSMYFPHDM
ARYFEALKDYKVGNCGDRALYAAHFIMDKYNFQGEVELLKLKGSGDHVFVRVGGTSDSAK
IIDPWTGQHFAHSQIKTFLYNPKEKKVEVHRSFDNLKALFKNLHLTSLNSLTKVQNHNVE
NWENVVVIPIADGGETRFDGQVIVQMENDSVVAKAAANLAGKHPENSVVVQLDSEGNYRV
VYGDPSKLDGKLRWQLVGHGRDDSEHNNTRLSGYSADELAVKLAKFQQAFGQAENISNKP
DHISIVGCSLVSDDKQKGFGHQFINAMDANGLRVDVSVRNSDVAVDTTGRKHTQDANGNW
VKKAANNKVSLTWNTQGEVTVRDEIIRNGVAEGDIHLSRVGASEVNEPARGAIGDNSEVF
EAPEKRKTETDTTASAGSDNKLSYSGNIQVNVGDGEFTAVNWGTSNVGIKVGTGGFKSLA
FGDNNVMVHIGNGDSKHSVDIAGYQALEGAQMFMGNRNVSFNMGRSNGLIVMMDKSIPTP
PLVNPFDGASRISGVLQSIAQSGKGADWLTAQEQQWTLSGAKKFVKEMSGLDQTSSVDYT
SLVDLDSQNERSSRGLKSDAEATLNKKYNQWLSGNSNNDTGKMSRADKFRQMNEKLAFNF
AVGGQGADIQVTTGNWNFMFGDNIQAILDTNLGSLFGVLTQQFSATGMAQTTFTYNPQDL
PRQLKNKLLGKFAEVGAETTLGDIFGVNYTADGKIVSRTDEAVDGVAILKEMLEVIGEFG
GEQLSAFTDPEKLLDSLKAGIDMGADGLQSFAESHGLKEKAPEENDTAQVTLNGAPAATE
NVSATVEETKPERAFGFNALNFPNLFATMFSKDKQTEMASLVSNLKQNLTADLLNMKDKT
FDFLRNSGHLQGDGDMNVSLGNYNFNWGGDGKDLGAYLGDNNNFWGGRGDDVFYATGVSN
IFTGGEGHDMGVLMGRENMMFGGDGNDTAVVAGRINHVFMGAGDDQSFVFGEGGEITMGS
GNDYAVTSGNFNRVDMGDDQDFAVTIGNNNQLDLGAGNDFARVFGNHNRIDAGQGNDEVK
LMGYHASINAGEGEDYLIAAAISKFSTLNGGEGNDVMVLGGYQNTFKGGAGVDSFVVSGE
VIDNVVEDIRQGENIIFNGIDWNRLWFERSGYDLKISMARHTDTSSDQTLFDALGCVTFN
DYFANNRAKLIIGLGEKDAQGEQEYTCLTDNALDNLIQAMSSFAPKVGESNFMDGLASQP
QQAIMAAWSDVNTGKFSLS
Download sequence
Identical sequences A0A1Y0NWZ1
WP_020977741.1.23305 WP_020977741.1.23371 WP_020977741.1.46886 WP_020977741.1.55957 gi|537454079|ref|YP_008487847.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]