SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_021513674.1.96695 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_021513674.1.96695
Domain Number - Region: 3-72
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0183
Family Pseudo ankyrin repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_021513674.1.96695
Sequence length 74
Comment hypothetical protein [Escherichia coli]; AA=GCF_001562695.1; RF=na; TAX=562; STAX=562; NAME=Escherichia coli; strain=SYAB3; AL=Scaffold; RT=Major
Sequence
MNNIKMITLFHPHDKTPFMICIINKVEDTELGLKLTLENGNNICVNNYSHYLLSESVSRC
DKDRLKNIYIRLVS
Download sequence
Identical sequences A0A1M0CW77
WP_021513674.1.14963 WP_021513674.1.15990 WP_021513674.1.19374 WP_021513674.1.24703 WP_021513674.1.46991 WP_021513674.1.47533 WP_021513674.1.51881 WP_021513674.1.53693 WP_021513674.1.55472 WP_021513674.1.58737 WP_021513674.1.65749 WP_021513674.1.66667 WP_021513674.1.67758 WP_021513674.1.74358 WP_021513674.1.80343 WP_021513674.1.81624 WP_021513674.1.85125 WP_021513674.1.96695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]