SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_022098109.1.40640 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_022098109.1.40640
Domain Number 1 Region: 9-75
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000385
Family Tetracyclin repressor-like, N-terminal domain 0.0078
Further Details:      
 
Weak hits

Sequence:  WP_022098109.1.40640
Domain Number - Region: 88-191
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0131
Family Pseudo ankyrin repeat 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_022098109.1.40640
Sequence length 207
Comment TetR family transcriptional regulator [[Eubacterium] eligens]; AA=GCF_001405395.1; RF=na; TAX=39485; STAX=39485; NAME=[Eubacterium] eligens; strain=2789STDY5834878; AL=Contig; RT=Major
Sequence
MSKAVEGVTEKIEEYARKEFKSKGYVDASLRTIAMEAGTTTGSIYSRYGGKEGLFSALVE
PAAREFTEIFEDVQKKFHAMESEMQTESLDEYSRNGMIQLVEYMYNHFEEFNLLVNCSYG
TKFQNFVEHLVDIETDYTYKYMEAVGLKFKEGRPLTKDFMHIMNTALFESFFEVVRHNMS
KEEAMEYIDLLEKYHSAGWSVIYDECK
Download sequence
Identical sequences A0A174YJ38 R6ABV3
WP_022098109.1.40640 WP_022098109.1.89035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]