SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_022347958.1.49420 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_022347958.1.49420
Domain Number - Region: 63-111
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00863
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_022347958.1.49420
Sequence length 115
Comment hypothetical protein [Bacteroides fragilis]; AA=GCF_000598205.1; RF=na; TAX=1339288; STAX=817; NAME=Bacteroides fragilis str. 3988 T1; strain=3988 T1; AL=Contig; RT=Major
Sequence
MKKLKSPASQSEAMKLRWKKRIVFEKGYTESCAEWMAERLEALLDHMQYGHATVAYRKQN
GSFQLVKATLIYYEAEFRKKYDPTKIEGAVVYWNVDEQRWMTFQVENFMEWRPIA
Download sequence
Identical sequences A0A015U0X0 R6Z8S9
WP_022347958.1.49420 WP_022347958.1.93484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]