SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_022560633.1.83433 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_022560633.1.83433
Domain Number 1 Region: 7-176
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.75e-29
Family Glutathione peroxidase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_022560633.1.83433
Sequence length 179
Comment peroxiredoxin [Vibrio nigripulchritudo]; AA=GCF_001050635.1; RF=na; TAX=1238432; STAX=28173; NAME=Vibrio nigripulchritudo ENn2; strain=ENn2; AL=Contig; RT=Major
Sequence
MGHSVKLKAGDKFPEISATLLDGSDVVLGQPQGDATWQAVIVYRGKHCPLCTKYLNEIES
HKKAFEELGIDILAVSGDAKHQLEAHLEQLDVSFPIAYGLTEEQMKTLGLYISKPRSEQE
TDHNFAEPGLFVVNENGGLQVVDIANSPFVRPELGALTRGLAWIRNPENNYPIRGTVDY
Download sequence
Identical sequences U4KB29
WP_022560633.1.100974 WP_022560633.1.41471 WP_022560633.1.79392 WP_022560633.1.83433 WP_022560633.1.85604 WP_022560633.1.99411 gi|549718399|ref|YP_008641032.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]